SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009380 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009380
Domain Number 1 Region: 647-837
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-46
Family SPRY domain 0.0000265
Further Details:      
 
Domain Number 2 Region: 28-117
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-30
Family RING finger domain, C3HC4 0.0062
Further Details:      
 
Domain Number 3 Region: 116-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.04e-17
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 352-434
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 5 Region: 440-502
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.58e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009380   Gene: ENSCAFG00000025025   Transcript: ENSCAFT00000010112
Sequence length 839
Comment pep:known chromosome:CanFam3.1:21:28603818:28654490:1 gene:ENSCAFG00000025025 transcript:ENSCAFT00000010112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAHLPRILEARSALEIPAGQARARGEATMTSAVLVDIRDEVTCPICLELLTEPVSIDCGH
SFCQACIMGNSTELVMGQDGESSCPVCQTSYQPGDLRPNRHLANIAERLREVVLGPGMQL
KVTLCAHHGEKLQLFCKEDGKLICWLCERSQEHRGHHTVLMEEVAHEYQEKFQESLGKLR
QEQQEAERLTAVIIGKRTSWKNQMEPERHRIQTEFNKLRSILDKEEQRQLKKLEEEERKG
LSILEEAENELVQQSETLRELISDLELRCQGSAMELLQDVSDVMKRSEFWTLKKPEALPT
KLKSMFRVPDLKKMLRVFRELTDVQSYWAIQELLSKKRLRSKYRKSQGRRTMALKILNIQ
DEVSCPICLELSTESRSLDCGHSFRQGCIAVNNKEAEISPRGESTCPLCGVRYSLSNLWH
NQHLVNIVERIRMFELNPEELLKRDLCVRHGKKLLLFCKEDRKVICWLCERSQEHRGHQT
FLVEEVVKEYQENLQAAVERLRKEQQKAEKLETDIRGERTSWKYQIQTERQRIRTEFNQL
RSILDSEEQRVLQKLEEEEKRILDNLAEGEAELAQQNQLVKELISDLEHRSKWSTVDLLQ
DMSGIMKWSEIWTLKKPKTVSKRLKSIFHAPDLSTMLRMCRELTQVQCYWAVDITLNPSN
LNLSLVLSEDQRQVMSVPIWPVKFSNYGILGSQYFSSGKHYWEIEVSKKTAWILGVYSRK
RFHNINLGVRQGTDNQNVYSRYRPQCGYWVIGLQNKFEYKAFEESSTSLPMVLTISMAVP
PHRIGVFLDYEAGIVSFLNVTNHGSLIYKFSKCCFSHTVYPYFNPWNCPGPITLCPPRS
Download sequence
Identical sequences E2QWC2
ENSCAFP00000009380 ENSCAFP00000009373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]