SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010037 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010037
Domain Number 1 Region: 499-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000131
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 44-71
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010037   Gene: ENSCAFG00000006733   Transcript: ENSCAFT00000010833
Sequence length 887
Comment pep:known_by_projection chromosome:CanFam3.1:25:11419126:11550685:-1 gene:ENSCAFG00000006733 transcript:ENSCAFT00000010833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFY
GEECQFLHEDPAAGAAPGLGLHSNSVPLALAGAPVAAFPPGAVPGGGAGPPPGPKKPDLG
GPGAGATAGGGGSSGVLDGPRLAIPGIDGGALTDTSLTDSYFSTSFIGVNGFGSPVETKY
PLMQRMTNSSSSPSLLNDSAKPYAGHDPLTSPASSLFNDFGALNISQRRKPRKYRLGMLE
ERLVPMGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGST
SRLSNVSQSNMSAFSQVFSHPSMGSPAAAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRR
SHTPNPANYMVPSSASTPVNNPVSQTPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPN
YHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYH
SLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMW
KKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNADAYFTKRKWGQH
DGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVG
VFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTIN
YSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRL
FRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLN
KLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences F1PKU0
XP_543150.3.84170 ENSCAFP00000010037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]