SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010134 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010134
Domain Number 1 Region: 194-285
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-20
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 83-179
Classification Level Classification E-value
Superfamily PX domain 0.00000000000628
Family PX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010134   Gene: ENSCAFG00000023888   Transcript: ENSCAFT00000010934
Sequence length 304
Comment pep:novel chromosome:CanFam3.1:1:116859787:116864770:-1 gene:ENSCAFG00000023888 transcript:ENSCAFT00000010934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWRGTEPRARSTDSLDGPGEGSVQPLPHTGGPSVKGKPGKRLSAPRGPFPRLADCAHFH
YENVDFGHIQLLLSPEREGPSFSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRC
IFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR
RLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGF
QVGFFPSECVELFTERPGPGLKGDADGPPCGVPTPQGVSSLTSAVPRPRGKLAGLLRTFM
RSRP
Download sequence
Identical sequences E2RDH9
ENSCAFP00000010134 ENSCAFP00000010134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]