SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010481 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010481
Domain Number 1 Region: 137-164,196-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-75
Family Nuclear receptor ligand-binding domain 0.00000000264
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010481   Gene: ENSCAFG00000016060   Transcript: ENSCAFT00000011311
Sequence length 462
Comment pep:known_by_projection chromosome:CanFam3.1:9:22254803:22289459:-1 gene:ENSCAFG00000016060 transcript:ENSCAFT00000011311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Download sequence
Identical sequences F1PN49 G9KK78
ENSCAFP00000010481 XP_004395071.1.74151 XP_004395072.1.74151 XP_004764652.1.14098 XP_004764653.1.14098 XP_005624393.1.84170 XP_005624394.1.84170 ENSMPUP00000014752 ENSMPUP00000014752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]