SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Canis familiaris 76_3.1 > ENSCAFP00000011293

Domain assignment for ENSCAFP00000011293 from Canis familiaris 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCAFP00000011293
Domain Number 1	Region: 146-275
Classification Level	Classification	E-value
Superfamily	Cyclin-like	3.67e-52
Family	Cyclin	0.000000356
Further Details:

Domain Number 2	Region: 10-144
Classification Level	Classification	E-value
Superfamily	Cyclin-like	7.78e-45
Family	Cyclin	0.000000359
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCAFP00000011293 Gene: ENSCAFG00000007614 Transcript: ENSCAFT00000012181
Sequence length	313
Comment	pep:known_by_projection chromosome:CanFam3.1:1:121687958:121697516:-1 gene:ENSCAFG00000007614 transcript:ENSCAFT00000012181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPSRASPLPLLNWANRDEVWKIMLNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCE VYKLHRETFYLAQDFFDRYMATQQNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVT DGACSGEEILSMELIIMKALKWHLSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQ IAELLDLCVLDVGCLEFPYGVLAASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMV IRETGSSKLKHFRGVPAEDAHNIQTHINSLDLLDKAQAKKAILSEQNRISPPPTGVLTPP QSSKKQSSGQDTA
Download sequence
Identical sequences	F1Q3X7 ENSCAFP00000011293 ENSCAFP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]