SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000014040 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000014040
Domain Number 1 Region: 912-1022
Classification Level Classification E-value
Superfamily SEA domain 1.96e-18
Family SEA domain 0.0078
Further Details:      
 
Domain Number 2 Region: 246-341
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000275
Family SEA domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000014040
Domain Number - Region: 1071-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000014040   Gene: ENSCAFG00000009552   Transcript: ENSCAFT00000015171
Sequence length 1254
Comment pep:known_by_projection chromosome:CanFam3.1:33:7703148:7785309:-1 gene:ENSCAFG00000009552 transcript:ENSCAFT00000015171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPHFGKISLGILIFVVIEGNLTSLTEDIQEPNSAVSFLLTDSESTDTSLSTEKKLPL
DHRETEKQWLLRRRRSILFPNGVKTCPGESVTEAVANHVKYFKVRVCQEAVWEAFRTFWD
RLPGREEYRYWMNLCEDGITTIFDMGTNFSQSVEHRSLIMKKLTDTKKTISRSCADHSLS
PEMSSPFPVGDTSTSGGAVLSIPYPGVTSYEGTSESSKERPEESISNEIENLIEESTKPA
TEQIAEFSIHLLGEQFSEELQDPSNLHHQHLVEEFISEVENAFTGLPGYKDIRVLAFRSP
KENGSHSGIDVHYAVTFNGEAIGNTTWDLISLHSNKVENHGLVELDDKPTAVYAISNFRD
YIAETLHQNFLLGNSSLNPDPDSLQLINVRGVLLPETEDQVWNTQSSSLQSTPPSILDNT
LQAEWPSADESTTSSISPLDFSSGPPSTTGRELWSESLLGDLVSTPKLAFPSKVGLSSSP
EVLDVSSLTLHSVTPAVLQIGLPVVSKERTSGSHILEDGLIKVEGSEDFLSVHPLPSGPF
THPVPKETIPSVEDSGVPSTSSPYLASSVSLDLLAKEITTPFGLDSLATKVKGQLEVSTF
MPDTSIEKEFIFESGLGSGSGQKVDLITWPWSETSLEKSSEPLSKSWLEDQGPLLPTEGI
DEKLVIDEKIDSTEQSIGRLTYGPFDRSTNFAEEELTGGPTVPIFAETTTQSASLILSKQ
ISEEPDVDYYSVTKAPLLLTSIVISASTDEPNLPFLKEDMEQTTESSKLEWFDKEVSVMK
PDMQHLGTTLPESDVVWTGTSLLGKLSRDTLASTPQSTDKLWLKSSMTQSTKLSPTTSST
LLEDEVIMGVQDISLELDRIGTDYYQPELIPEEDGKVGSYVEMSTNVHSTERAIVAQPTE
GGDLSHTQTAGALVVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLSGF
QNLEILNFRNGSIVVNSRMKFAKSVPPNVNNAVYMILEDFCTTAYQTMNLAIDKYSLDVE
SGDQANPCKFQACNEFSECLVNPWSGEAECRCFPGYLSVEELPCQSLCDLQPGFCLNDGK
CDIMPGHGAICRCRVGENWWYRGKHCEEFVSEPLVIGITIATVVGLVLVFSALVFFLVRT
LKAHYVRREAERPISSIRQPDSLSSIENAVKYNPVYESHVARPEEYEGPYPQNPFYSSGG
GEMIGGLSREEIRQMYENSELSSEEIQERMRILELYASDPEFVAFVREHQMEEL
Download sequence
Identical sequences E2RPB6
ENSCAFP00000014040 ENSCAFP00000014040 9615.ENSCAFP00000014040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]