SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000016488 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000016488
Domain Number 1 Region: 178-301
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.44e-59
Family Dystroglycan, domain 2 0.000000335
Further Details:      
 
Domain Number 2 Region: 494-595
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 59-157
Classification Level Classification E-value
Superfamily Cadherin-like 9.26e-18
Family Dystroglycan, N-terminal domain 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000016488   Gene: ENSCAFG00000011207   Transcript: ENSCAFT00000017810
Sequence length 892
Comment pep:known chromosome:CanFam3.1:20:39707529:39890419:-1 gene:ENSCAFG00000011207 transcript:ENSCAFT00000017810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSAGLSLLLPLWGRTFLLLLSVAMAQSHWPSEAGRDWENQLEASMHSVLSDLHEAVPT
VVGIPDGIAVVGRSFRVTIPMDLIASNGELVKVSAVGKEVLPSWLHWDPQSHTLEGLPLD
TDKGVHYISVSATRLGANGSHVPQTSSVFSIEVYPEDHSEPQSVRAASPDPAEVVSSACA
ADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAFMA
GPGNAKKVVENGALLSWKLGCSLNQNNVPDIHGVEAPAREGAMSAQLGYPVVGWHIANKK
PPIPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVP
GKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTT
TKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTT
TSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQ
QLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDR
APARFKAKFMGDPVPVVNDIHKKISLVKKLAFAFGDRNCSTITLQNITRGSILVEWTNNT
LPLEPCPKEQIMALSQRIAEDNGKPRAAFSNALEPDFQASSIAVTGSGSCRHLQFIPVAP
PRRVPSEVPSTDVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKL
TLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLN
QDTVGEYTPLREEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q9TSZ6
NP_001029164.1.84170 XP_005632375.1.84170 XP_005632376.1.84170 ENSCAFP00000016488 ENSCAFP00000016488 9615.ENSCAFP00000016488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]