SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000017492 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000017492
Domain Number 1 Region: 83-248
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-38
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 316-455
Classification Level Classification E-value
Superfamily PapD-like 1.62e-37
Family MSP-like 0.00000024
Further Details:      
 
Domain Number 3 Region: 22-81
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000127
Family CRAL/TRIO N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000017492   Gene: ENSCAFG00000011879   Transcript: ENSCAFT00000018876
Sequence length 516
Comment pep:known_by_projection chromosome:CanFam3.1:X:11148120:11198602:1 gene:ENSCAFG00000011879 transcript:ENSCAFT00000018876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYHAQNKAKLISETRRRFEAEYVTDKPDKYDPRDVERLQQDDNWVESYLLWRHNVVDETL
KMLDESFQWRKEMSVNDLTESSIPRWLLEIGGIYLHGYDKEGNKLFWIRVKYHVKDHKTM
LDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKM
VIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYP
PLVDDDFQTPLCENGPIASEDEASSKEDIESDGKETLETVSNEEQTTLLKKINVTEHTSK
AEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNVVAF
KVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAE
LTQFWKEVPRNKVMEHRLRCHIVESSKPTTLTLKDSGFNMSDKTSEDLYLQLNRLLESNR
KLEDQVQRCIWFQQLLLSLTMLLLAFVISFFYLLYS
Download sequence
Identical sequences F1PHA9
ENSCAFP00000042205 ENSCAFP00000017492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]