SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000018212 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000018212
Domain Number 1 Region: 438-684
Classification Level Classification E-value
Superfamily vWA-like 2e-70
Family Trunk domain of Sec23/24 0.00013
Further Details:      
 
Domain Number 2 Region: 686-781
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.01e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 3 Region: 165-455
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.97e-36
Family beta-sandwich domain of Sec23/24 0.0043
Further Details:      
 
Domain Number 4 Region: 888-1029
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.18e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 782-887
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.1e-29
Family Helical domain of Sec23/24 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000018212   Gene: ENSCAFG00000012345   Transcript: ENSCAFT00000019635
Sequence length 1033
Comment pep:known_by_projection chromosome:CanFam3.1:32:37688740:37792611:-1 gene:ENSCAFG00000012345 transcript:ENSCAFT00000019635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPAYSQSQPGIGLSSPHYGHYGDPSHAGSAPGMMKPAGPLGAAAPGGMLPQG
PSPPGPHQFGQSGAHAQGHPPQRFTGPPPVNSAAPVNSAAPSYAPYSPSAQSSYPSPAST
SSVTQLGNQFNAMHINSYGSGMAAPVQGPPGPPSAPSFQGPSRPPQPSIMQPGSQVLPPP
PTALNGPGASPLPPSTHRQDGLPGPQYQPPPLPGQTLGPGYSPQQANYGLQMAGGQLAYP
GGFPGGPAQMAGPPQLQKKLDPDSIPSPIQVIENDRATRGGQIYATNTRGQVPPLVTTDC
VIQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAIIKPFATIPSNETPLYLVNHGENG
PVRCNRCKAYMCPFMQFIEGGRRYQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPELSL
GSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLEKLPKEEQEE
TSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNL
LDQIPEMFADSNENETVFAPVIQAGMEALKAADCAGKLFIFHSSLPTAEAPGKLRNRDDK
KLINTDKEKILFQPQTNVYDSLAKDCVAHGCCVTLFLFPSQYVDVASLGLVPQLTGGTLY
KYNNFQMHMDSQQFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEMA
AIDCDKAVTVEFKHDDKLGEDSGALIQCAVLYTTIGGQRRLRIHNLSLNCSSQLADLYKS
CETDALINFFAKSAFKAVLHQPLKVIREILVNQTAHMLACYRKNCASPSAASQLILPDSM
KVLPVYMNCLLKNCVLLSRPEISTDERAYQRQLVMTMGVADSQLFFYPQLLPIHTLDVKS
TTLPAAIRCSESRLSEEGIFLLANGLNMFLWLGVSSPPELVQGIFNVPSFAHVNTDMTLL
PEVGNPYSQTLRMIMSIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDF
LCCVHKEICQLLN
Download sequence
Identical sequences E2RSG8
ENSCAFP00000018212 XP_535702.3.84170 ENSCAFP00000018212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]