SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019240 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019240
Domain Number 1 Region: 810-1000
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.14e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 39-428
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.51e-60
Family L-arabinose binding protein-like 0.00035
Further Details:      
 
Domain Number 3 Region: 506-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-46
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019240   Gene: ENSCAFG00000013037   Transcript: ENSCAFT00000020726
Sequence length 1073
Comment pep:known_by_projection chromosome:CanFam3.1:27:31917604:31990025:1 gene:ENSCAFG00000013037 transcript:ENSCAFT00000020726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMILLGLALWSLLLRPGVMYWASQISQNCNNGSYEISVLMMNNSAFPESLDNLKEAVNE
GVEIVRQRLLNAGKNVTVNATFIYSNTVIYKSSDCRSSTCEGIDLLREISNNKRMGCVLM
GPSCTYSTFQMYLDTDLNYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVDFWKANNL
PFKDYSWKTAYVFKNSTESEDCFWYLNALEAGVSYFSQELSFKEMLRRDDQFQDILMNQN
RKSNVIVTCGTPSTINSLKGDRAVAEDIVIILVDLFNNDYFVDNVTAPDYMKNVLVLTLP
PEYSISNSSFSKGTPQAKNNFALAYLNGVLLFGHMLKTFLENGEAITTPKFAQGFRNLTF
EGHAGPVTLDDCGDIDNTMMLLYTSVDTNKYKVLLTYDTHINKTTRVDKRPTFIWMNHKL
PNDIPGQGPQILLIAVFTLTGAVVLLLLIALLVLRKYKKEYELRQKKWSHIPPENIFPLE
TNETNHISLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGIIAQEIILRRETFYTLSCRDQNEKIFRVENANGVKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIESTLAKIFGLFHDQKSESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALDI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGTETTYWLTGVKGQEYNLPTPPTVENQQ
RLQAEFSDMLANSLQKRQAAGIRSRKPTRVASYKKGTLEYLQLNTTDNENPQA
Download sequence
Identical sequences F1PAG3
ENSCAFP00000019240 9615.ENSCAFP00000019240 ENSCAFP00000019240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]