SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019591 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019591
Domain Number 1 Region: 1309-1386
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 923-997
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000113
Family I set domains 0.06
Further Details:      
 
Domain Number 3 Region: 706-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1207-1283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000769
Family I set domains 0.032
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1477-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000085
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 1425-1483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000549
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 815-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 11 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000981
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 760-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 13 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 1603-1658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 15 Region: 646-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000837
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019591   Gene: ENSCAFG00000013288   Transcript: ENSCAFT00000021096
Sequence length 1694
Comment pep:known_by_projection chromosome:CanFam3.1:3:55358797:55695236:1 gene:ENSCAFG00000013288 transcript:ENSCAFT00000021096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWKSSWWLLMWMVFMHSALLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTRSDEEKDSNWDAWGSWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPAAPCALKCHARGQNLVVELAPKV
LDGTRCSTDSLDMCISGICQAVGCDRRLGSSAREDSCGVCAGNGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKREHSFNSPGVFVIENTTVEFQK
GSERQTFKIPGPLMADFIFKTRYTVAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLKLHIKEECIIPIPCYKPKEK
SPVEAKLPWLKQAQEVEETRIATEEPTFIPEPWSACSTTCGLGIQVREVKCRVLLTFTQT
ETELPEEECEGPELPTERPCLLKPCEESPASHELDASLQEDSRMTYHWEYAGFTPCTATC
LGGHQEAIAVCLHTQTQQTVSDTLCDLVHRPPAMSQACNTEPCPPRWYTGSWGPCSATCG
VGIQTREVYCLHPGESPAPAEECGDEKPHALQACNQFDCPPSWHIEEWQQCSRTCGGGTH
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHITVGDWSKCSVSCGVGTQ
RRKQVCQRLTAKGRRVPLSEMMCRDLPGPPLMRPCQMPACNKVKPEKKTKASEQGPQILD
VQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHSLAAPDIGTYRCIAGPAQETVVLKLIGTDNRLIAPPALREHTREYPGMDH
SETNGLGATWQKMRQIWGNKNELHPDDGQIDNQPFLRALLGACNNIGGNTNSWEFKNKQF
EAAVKQGAYSMDTAQFDELIRNMSQLMETREVSDDLASQVIYQLVAELAKVPPAHSQWRG
VQEGVPPAAHLRGETRSMPQSSNVENSGKLTFKLKGPVLMRQSQPTSMSFNKTINSRIGD
TVYITKRTEVINILCELVTPSQATYTWTKDGALLQPSEKIVLAGMGKMQIRNPTKKEQGT
YGCSVANHLGSDVESSPVLYAEAPAILSIERNISRLEHSHLSVVVGGIIEAALQADVTIQ
CPVKGVPQPNITWLKRGGSLSDNISLLFNGSLLLQNVSLENEGTYVCTATNVLGKAVAAS
VLHVLEQRRLDSKSVFPKDHKKHMLQASNTGTNSNDPTGEPLPPEPFWELGNWTHCSATC
GHLGTRVQRPRCVLATGQEVSEAFCQHLQKPLAGFQPCNIRDCPPRWLTGAWSECSVSCG
EGFHSRQVACKRIKANGTVQVVSPRACAPTERPLGRRPCSIHPCGQWVVEPGGQCPARCL
GRPGRMQQHHAVCQHHNSSDPRCDDRRRPSLRRNCSSRACDTCWRTGPWRPCTAACGRGF
QSRKVECVRARSCRPVAERHCVQEKRPASWRHCLGPSCDRDCSDTTHYCMFVKHLSLCSL
DLYKQRCCRSCQEG
Download sequence
Identical sequences F1PF84
ENSCAFP00000019591 ENSCAFP00000019591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]