SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019664 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019664
Domain Number 1 Region: 336-466
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-40
Family C-type lectin domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 193-328
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-36
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 770-904
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-35
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 4 Region: 477-612
Classification Level Classification E-value
Superfamily C-type lectin-like 4.3e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 917-1068
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-33
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 6 Region: 620-765
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-29
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 7 Region: 1206-1345
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-27
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 1075-1198
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-25
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 2-130
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.34e-24
Family Cysteine rich domain 0.0036
Further Details:      
 
Domain Number 10 Region: 130-188
Classification Level Classification E-value
Superfamily Kringle-like 1.51e-20
Family Fibronectin type II module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019664   Gene: ENSCAFG00000013256   Transcript: ENSCAFT00000021177
Sequence length 1423
Comment pep:known_by_projection chromosome:CanFam3.1:9:10849790:10871360:1 gene:ENSCAFG00000013256 transcript:ENSCAFT00000021177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFVIFSHGLQGCLEAQGGQVRVSSSCNASLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTN
TTASLGMYECDREALNLRWHCRTLGDQLSLLLGGRTGNSSKAGGLERGDQTRSGQWRIYG
SDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATTQDYGKD
ERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQ
TYINGLLTGYSSPLWIGLNDLDTRGGWQWSHNSPLKYLNWENDQPDNPSEENCGVIRTES
SGGWQNRDCSIALPYVCKKKPNATAERPPPDVWANVKVECEPSWQPFQGHCYRLQAEKRS
WQESKKACLRGGGDLLSIHSMAELEFITKQINIPEVEELWIGLNDLKLQMNFEWSDGSLV
SFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGC
RKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWDGEYFW
TALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTAFRAR
YICRQSLGTPVTPELPGPDPTPSLTGSCPQGWGSDPKLRHCYKVFSSERLQDKKTWVQAQ
GACQELGAQLLSLASYEEEHFVANMLNKIFGIHEQNWFWIGLNRRDPGAGQSWRWSDGLG
FSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRVPRSHCPPAGRREW
LRFQDTEYKFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNLQKFSRGQEQHWWI
GLHTAESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTASREDWGDQRCLTALPYI
CKRSNSTGEPQPPDLPPTALGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEA
QLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYTNWAPGEPSGPSPA
PSGNIPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAASPPAPGTE
LSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVPDPYTQAFLTQAARGLRTPLWIGLTS
EEGSRRYSWVSEEPLSYVSWQDGEPQQPGGCAYVDVDGAWRTASCDTKLQGAVCGPPPPR
RISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSILDEMENVF
VWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQ
SSSGLWRPGACTNITMGVVCKLPRDETANPSSALPENPAALVVVLMAVLLLLALLTAALI
LYRRRQSVERGTFEGARYSRSASGPGEATEKNILVSDMEMNEQ
Download sequence
Identical sequences F1PCT2
ENSCAFP00000019664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]