SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000019942 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000019942
Domain Number 1 Region: 112-236
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000000116
Family Cyclin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000019942   Gene: ENSCAFG00000013539   Transcript: ENSCAFT00000021474
Sequence length 312
Comment pep:known_by_projection chromosome:CanFam3.1:37:16075515:16110782:1 gene:ENSCAFG00000013539 transcript:ENSCAFT00000021474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTLTCCVSSNASPKLGRGTGPADPDYESDVYQAAAGDAVAVAPAPATVEPAELDFGAG
EGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILP
HKEQREKVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICP
TNWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPSS
VYAKYYFDLRSLADDNNVNFLFAPLSKERAQNLEAISRLCEDKYKDWSRAAMRRSFSADN
FIGIQRSNAILS
Download sequence
Identical sequences F1PYE7
ENSCAFP00000019942 XP_545613.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]