SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020093 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020093
Domain Number 1 Region: 66-173
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 9.16e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 486-589
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 352-454
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020093   Gene: ENSCAFG00000013639   Transcript: ENSCAFT00000021637
Sequence length 590
Comment pep:known_by_projection chromosome:CanFam3.1:6:7555078:7564719:-1 gene:ENSCAFG00000013639 transcript:ENSCAFT00000021637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSERPPPGWLHKEAEMRIGLQPAEKSRGWRPGDRSAAPSPLPPALSFLLLLPLASAVQ
PTSLPFPELRLVGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECGGQEAALSQCRSRGWGVHNCFHYEDVAVLCDEFLPTQLPTRK
VIISRAPPTTPQNGKGEGSVRLVGGAGPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGAALAATTNAFFGYGTGHILLDNVHCEGSEPHLAACLSLGWGVHNCGHHEDAGALCA
VLGPPTFTALPSLATREDWAWHTDLEATGVGALPSREMALFTTATWASGKSGRLRLVGGP
GPCRGRVEVMYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDN
VGCAGTEARLSDCFHLGWGQHNCGHHEDAGALCSVLSEPGPEELGLQGQQDGSETTRMPT
PRPRDGHLRLANGAHQCEGRVELFLGQRWGTVCDDAWDLRAATVLCRQLGCGQALAAPGE
AHFGPGQGPILLDNVKCRGDESALLLCSHIRWDAHNCDHSEDASVLCQPL
Download sequence
Identical sequences F1PYP4
ENSCAFP00000020093 ENSCAFP00000020093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]