SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020517 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020517
Domain Number 1 Region: 723-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 28-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000589
Family Somatomedin B domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000020517
Domain Number - Region: 64-136
Classification Level Classification E-value
Superfamily E set domains 0.0014
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020517   Gene: ENSCAFG00000013923   Transcript: ENSCAFT00000022094
Sequence length 821
Comment pep:known_by_projection chromosome:CanFam3.1:26:28357193:28363924:-1 gene:ENSCAFG00000013923 transcript:ENSCAFT00000022094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLVLLWALLLLATAPGPGPRPAAGAQGSCSHRCGDRDGSCSCHPTCSGLGTCCSDFRD
FCLEVSPYSGSMMGGKDFQVQHLTWFIPTDGVICRFKESIQTLGYVDSSGHVHCVSPLLY
ETGHIPFTLSMDNGRSFPRSGTWLAVHPSKVSETEKSQLENETLWQYYGTAGTTDNLTVT
WEPSALPTRSVTIELWGYEETGKPYSGEWTAKWSYLYSLATSIPNSGFFTFTPKPAPPNF
QRWEVGALRIISSRYYAGEKDVQALWSNEHALAWHLGEDFRADPKAWARAQCLAWEQLED
QLPNFLEELPDCPCTLAQARADSGRFHVSPPPPPPAPNLGTHPPGGLDWVRSVQASPRFA
SGQQCCYTEAGSLLLTADSTGGSTPDRGHDWGAPPFRTPPRVPGLSHWLYDVVSFYHCCL
WAPECSRYMRRRPSSDCRSYRPSRLASAFGDPHFITFDGASFSFNGRGEYVLLEAELTNL
RVQGRAQPRTTPEGPQDRGTGLTAVAVQEGNSDVVEVRLAGGAGVLQVLLNQEVLSFTEQ
SWMDLKGMFLSVAAGDSVSIMLSSGAGLEVSVQGPFLSVTVLLPEKFLTHTQGLLGTLND
DPTDDFVLRDGNVLPPKASSRELFRFGADWAVRNTSSLLTYDSWFLVNNFLYQPKHDYTF
QPLFPEETTPNPSQAAEAAKLCGDNYFCIFDVMATGSLSVGNATRMAHQWHQHRAQSLQP
VTSCGWLAPPPNGRKEGTRYLSGSTVYFHCDSGYSLVGAEVSTCQADGIWSRPTPMCQPA
RSYTVLLSIIFGGLAVVAVVALVYVLLRHRKGNMAIWGSQP
Download sequence
Identical sequences E2RSH4
ENSCAFP00000020517 ENSCAFP00000020517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]