SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000020995 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000020995
Domain Number 1 Region: 461-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-69
Family Eukaryotic proteases 0.00000000786
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-30
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 3 Region: 206-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-26
Family Spermadhesin, CUB domain 0.0000355
Further Details:      
 
Domain Number 4 Region: 390-469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0000252
Further Details:      
 
Domain Number 5 Region: 322-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0000189
Further Details:      
 
Domain Number 6 Region: 152-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000020995   Gene: ENSCAFG00000014220   Transcript: ENSCAFT00000022610
Sequence length 719
Comment pep:known_by_projection chromosome:CanFam3.1:27:37951909:37960557:1 gene:ENSCAFG00000014220 transcript:ENSCAFT00000022610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVRCKMAREENAERWLFYLLVPILFCNMGGSIPLSQKLFGEVTSPLYPKPYPNNLDKTT
VITVPTGFRVKLVFWQFDLEPSEGCLYDYVKISADKKTLGRFCGQLGSPLGNPPEAREFV
SQGNKMQLTFHTDFSNEENGTIMFHKGFLAYYQAVDLDECASQLNSLEENLQPQCQHLCH
NYVGSYFCTCRPGYELQKDGHSCQAECSNELFTEPSGYVSSLEYPQPYPPDLRCNYSIRV
ERGLTLHLKFLEPFEIDDHQQVHCPYDQLQIYANGRNIGEFCGKKRPTDFDTSSNAVDLL
FFTDESGDSRGWKLHYVTEVIKCPQPKTLDKFTIIQDVQPQYQFRDYFIATCQQGYQLVE
GNQVLLSFTAVCQDDGTWHRAMPRCRIKDCGPPRSLTNGAFNYTTTKGVNTYQARIQYYC
QEPYYKMHTRGGISEIQRGAYTCTAQGIWKNEWEGEKIPRCLPVCGKPVNPVEQKQRIIG
GQKAKLGNFPWQAFTNIYGRGGGALLGDRWILTAAHTLYPKDHDAQSNATVDVFLGHVSV
EEITKLANHPVRRVSIHPDYRQDESHNFEGDIALLELENSVTLGPNLLPICLPDNETFYD
RGLMGYVSGFGIMEERLSYDLKFIRLPVAKREACESWLRKNKRKDVFSQNMFCAGDPSLK
QDACQGDSGGVFAVKDENSDRWVATGIVSWGIGCSRGYGFYTKLLNYVDWIKKEMEGEG
Download sequence
Identical sequences F1PNG7
ENSCAFP00000021026 ENSCAFP00000020995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]