SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000021901 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000021901
Domain Number 1 Region: 143-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.11e-39
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 2 Region: 33-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00063
Further Details:      
 
Domain Number 3 Region: 333-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-32
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 4 Region: 967-1020,1082-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-31
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 5 Region: 777-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-28
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 571-628
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000139
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000021901   Gene: ENSCAFG00000014854   Transcript: ENSCAFT00000023588
Sequence length 1378
Comment pep:known_by_projection chromosome:CanFam3.1:9:20294274:20307566:-1 gene:ENSCAFG00000014854 transcript:ENSCAFT00000023588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMCLRLLCILLAAVSGTRGWGYYGCDEELVGPLYARSLGASSYYGLFTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
ATFFGNVNESAIVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKSDVLYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGVQGDYITLELQGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGREANLTLDGYVQRFVLNGDFERLNLDNE
MFIGGLVGAAQKNLAYRHNFRGCIENIIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRFAVSFRFRTWDLTGLLLFSRLGDGLGHVELMLSEGQVN
VSIAQTGRKKLQFAAGYRLNDGFWHEVNFAAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRSGCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGYYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWMGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWLEYDQPLYVGSAELKRRPFVGCLRAMRLNGMTLNLEGRANASEGTSPNCTGH
CAHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPEYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTDSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KATHDYHPGSKPPLPTSGSAQVPAPTPASAPAPAPAPAPSSGPRDQNLPQILEESRSE
Download sequence
Identical sequences F1PDN4
ENSCAFP00000021901 9615.ENSCAFP00000021901 ENSCAFP00000021901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]