SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022424 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022424
Domain Number 1 Region: 2063-2221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000479
Further Details:      
 
Domain Number 2 Region: 1902-2062
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000183
Further Details:      
 
Domain Number 3 Region: 1578-1755
Classification Level Classification E-value
Superfamily Cupredoxins 9.68e-48
Family Multidomain cupredoxins 0.000033
Further Details:      
 
Domain Number 4 Region: 349-533
Classification Level Classification E-value
Superfamily Cupredoxins 3.49e-45
Family Multidomain cupredoxins 0.0000415
Further Details:      
 
Domain Number 5 Region: 34-199
Classification Level Classification E-value
Superfamily Cupredoxins 5.71e-43
Family Multidomain cupredoxins 0.000000101
Further Details:      
 
Domain Number 6 Region: 540-663
Classification Level Classification E-value
Superfamily Cupredoxins 3.72e-37
Family Multidomain cupredoxins 0.00019
Further Details:      
 
Domain Number 7 Region: 1763-1902
Classification Level Classification E-value
Superfamily Cupredoxins 5.12e-33
Family Multidomain cupredoxins 0.000000634
Further Details:      
 
Domain Number 8 Region: 207-329
Classification Level Classification E-value
Superfamily Cupredoxins 8.6e-32
Family Multidomain cupredoxins 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022424   Gene: ENSCAFG00000015215   Transcript: ENSCAFT00000024154
Sequence length 2222
Comment pep:known_by_projection chromosome:CanFam3.1:7:28999512:29069232:1 gene:ENSCAFG00000015215 transcript:ENSCAFT00000024154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGCARLWVLVLLGASCTGWGSWGSWGAEAARLRQFYVAAQGISWNYRPEPTNPSSNTS
FKKIVYREYEPYFQKEKPRSKISGLLGPTLYAEVGDIIKVHFKNKADKPISIHPQGIKYS
KFSEGASYSDHTFPMEKMDDAIAPGQEYTYEWHISEDSGPTHNDPPCLTHIYYSYDNLIQ
DFNSGLIGPLLICKKGTLTENGIQKMFDKQHVLMFAVFDESKSWSQSSSLMYTVNGYVNG
TMPDITVCAHDHISWHLIGMSSGPELFSIHFNGQVLEQNHHKISAITLVSATSTTANMTM
SPQGRWIISSLITRHFQAGMQAYIDIKNCAKKTRNPKKLTRDQRRYMKRWEYFIAAEEVI
WDYAPVIPANMDKKYRSLHLDNFSNQIGKQYKKVVYKQYQDESFTKRLENLNIKEDGILG
PVIRAQVRDTLKIVFKNMASRVYSIYPHGVTFSPYEDEVNSSFTSDNNTMIRAVQPGETY
TYKWNILESDEPTENDAQCLTRPYYSNVDVTRDIASGLIGLLLICKSRSLDKRGIQRAAD
IEQQAVFAVFDENKSWYIEDNINKFCENPDKVKRDDPKFYESNIMSTINGYVPESIPTLG
FCFDDTVQWHFCSIGTQDDILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGTW
MLTTINSSPRSKNLRLRFRDVKCIRDDYEDSYEIIYESLAPTVMTTRKMRDSPEDNGDEN
DADYDYQNNLASWLGIRSFRNSSLNQEEDEFNLTALALENNSEFDPPNTDTALNSNSSSL
RNFSRLIVYNFAKPQKTLPHPEATTAGPPLGHIGLDKNSVLNHSTAEHSSPYSEDSMEDP
LQSDITGVKLLPLDAEGFRNQEHARHKGGEHTAKHKFSQVGFSAPKPGRHLSQGNSSPSR
IGPWKDLPNDLLLLKQNNPSKILNGKWHLVSEKGSYEIVPDAEDMAVDKLLDSPQNTSKS
WGESIPLSNKHRKQSGYPKFSGVRNKTLQVKWDRGNGGLKKSLFLIKTRKKKKEQKLAHP
IPLSPRSFHPLRGKANTTFSDRRLDHSSLLHKSNGRSFPAGLNQTFPSLNLTLLASLPDH
NQNPPNDTSQTSSPLDLYQTVLPEEHYQTFPIQDSNSMHSTVDSSHTSPPEPGQMQDYDL
RHEPFPTDIGQMFPSLEPEAWQATISADLDQTTLFPDLSKTTLSPDFDQTTLSPDLDQTT
FSPDLDQTTFSADLSQTTLSPDFDQTMLSPDLDQTTFSPDLSQTTLSPDLSKTTLSPDFD
QTTLSPDLDQTTFSPDLDQTTFSPDLSQTTLSPDLSKTTLSPDFDQTTLSPDLDQTTFSP
DLDQTTFSPDLSQTTLSPDLSKTTLSPDFDQTTLSPDLDQTTFSPDLDQTTFSPDLSQTT
LSPDLSQTTLSPDFDQTTLSPDLDQTTFSPDFGQTILSPDFDQILLSPDLSQATLSPDIS
QTALPPDLRQTSLPLDLDQTSYTSESSPSILLPEFGQTLPYPDLGQVPSLTPSPTLNNAF
PPEELNPPVVVGLSANDGDYIEIIPRQKEESSEEYSAEIGYVTYDDPYQTDTRTDINSSR
NPDNIAAWYLRSNNGNRKYYYIAAEELYWDYSKFAQSEDVDDHIHAQENTVYKKVVFRKY
LDSTFTKRDPLGEYEEHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEG
KTYEDDSPEWFKEDNAVQPNSSYTYVWHATTRSGPENPGSACRAWAYYSAVNPEKDIHSG
LIGPLLICRKGVLDKSNTPMDIREFVLLFMVFDEKKSWYYKKKAQSPRSWRLTSSEAKHS
HEFHAINGMTYNLPGLRMYEQEWVRLHLLNMGGSRDIHVVHFHGQTLLENGTQQHQLGVW
PLLPGSFKTLEMKSSKPGWWLLNTEVGENQRAGMQTPFLIIDRECKMPMGLSTGIIADSQ
IKASEHLGYWEPKLARLNNGGSYNAWIPEKPSTELDSKPWIQIDMQREVVFTGIQTQGAK
QYLKSYYTMEFYVAYSSDRTNWQIFKGNSTRNVMYFDGNSDASTIKENNFDPPIVARYIR
ITPTRSYNRPALRLELQGCEVNGCSTPLGMESGKIENKQITASSFKKSWWGDYWEPFRAR
LNAQGRVNAWQAKANNNKQWLQIDLLKIKKITAIVTQGCKSLSSEMYVKSYTIHYSDQGM
EWKPYRQKSSMVDKIFEGNNNVKGHVKNFFNPPIISRFIRIIPKTWNQSIALRLELFGCD
IY
Download sequence
Identical sequences F1PN98
ENSCAFP00000022424 ENSCAFP00000022424 XP_005622605.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]