SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000022845 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000022845
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 3.54e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000524
Further Details:      
 
Domain Number 2 Region: 205-334
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.57e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 394-454
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000034
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000022845   Gene: ENSCAFG00000015519   Transcript: ENSCAFT00000024623
Sequence length 466
Comment pep:known_by_projection chromosome:CanFam3.1:X:41882987:41892888:1 gene:ENSCAFG00000015519 transcript:ENSCAFT00000024623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGRKCWTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLW
EQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRR
QLPSPPAPVSEERRGGPPPLPPHPAGDQGGPATGPLSLGLVTVDIQNPDITSSRYRGLPA
LGPGPTDKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRKLFSKAGIS
EAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQASRPPTIGSNKG
RSGPLPPVPLGNAPPPPTPRGPPPSGRGGPPPPPPPATGRSGPLPPPPPGAGGPPVPPPP
PPPPPPPPPSSEEGPVPPPPPALGPSGGPTPGGGRGALLDQIRQGIQLNKTPGAPESSAL
QPPTQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDDDDEWDD
Download sequence
Identical sequences F6X487
XP_005641380.1.84170 ENSCAFP00000022845 ENSCAFP00000022845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]