SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023387 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023387
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 5.78e-56
Family Necap1 N-terminal domain-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023387   Gene: ENSCAFG00000015895   Transcript: ENSCAFT00000025191
Sequence length 275
Comment pep:known_by_projection chromosome:CanFam3.1:2:81276397:81289341:-1 gene:ENSCAFG00000015895 transcript:ENSCAFT00000025191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGEYESVLCVKPEVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQVAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGTPRARPA
STGGLSLLPPPPGGKTSTLIPPPGEQLSGGAPVVQTAVAPSSGRLPVRLNQAQAGSSSDL
SIPFFFLITISGKEPPHLGQRKEDEALPGQLLFGA
Download sequence
Identical sequences E2QYI2
XP_005618007.1.84170 ENSCAFP00000023387 ENSCAFP00000023390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]