SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023840 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023840
Domain Number 1 Region: 628-772
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.92e-43
Family Toll/Interleukin receptor TIR domain 0.000000446
Further Details:      
 
Domain Number 2 Region: 4-165,348-566
Classification Level Classification E-value
Superfamily L domain-like 2.04e-42
Family Ngr ectodomain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023840   Gene: ENSCAFG00000016175   Transcript: ENSCAFT00000025668
Sequence length 807
Comment pep:known chromosome:CanFam3.1:3:73568321:73570744:1 gene:ENSCAFG00000016175 transcript:ENSCAFT00000025668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRIRSIYIFCSIAISVQGWASKLPEERELTTNCSNMSLRKIPADLTPTTTTLDLSYNLL
SQLQSSDFRSVSKLKVLILCHNRIQELNIKIFEFNRELRYLDLSYNRLKIVTWYSLAGLR
HLDLSFNDFDTVPICEETGNMSHLEILGLSGAKIQKSNFQKIAHLHLKTVFLGLRSLSHY
EEGSLPILNTTKLHIVLPMNTNFWVLLHDGIKTSKILEMTNIDGKSQFASYGTQKNLTLE
NSKTSILLLNKVDLLWDDLLLIFQFVWHTSVECFQIQHLTFGGKVYLDHYSFDYSNTVMR
TIKLEHVQFRIFYIPQERVYLLFTKMDIENLTISDAQMPYMLFPIYPTRFQYLNFANNIL
TDDLFKQPIQLPHLKTLILKGNKLETFSLVSFFANNTSLKHLDLSQNLLQHENGENCFWP
ETLITMNLSSNKFADSVFRCLPRNIQILDLNNNKIQTVPKDIIHLKSLQELNLAFNFLTD
LPGCSHFRKLSILNIEMNLILSPSLDFFQSCQEVKILNAGRNPFRCTCELRDFIQLEEYS
EGMMIGWLDSYICEYPLTLKGTLLKDVHLPELSCNTTLLIVTIVVIMLVLGMAVAFCCFY
FDLPWYLRMLGQWTLQRIRKTTQEQLKRNVQFHVFIAYSEHDSTWVKHELIPNLEKKEKL
ICLHEGNFDPGKSIIENIMNCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHSLFHENSDY
IIFILLEPIPLYCIPTKYPKLKALMEKKAYLEWPKDRRICGLFWANLRAAINANLLETRE
MYELQTFVGLNEESQGSAISLIRTDCL
Download sequence
Identical sequences E2R0Q4
ENSCAFP00000023840 9615.ENSCAFP00000023840 NP_001166598.1.84170 XP_005618299.1.84170 XP_005618300.1.84170 ENSCAFP00000023840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]