SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000023896 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000023896
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 929-1050
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 158-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-20
Family Phosphotyrosine-binding domain (PTB) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000023896   Gene: ENSCAFG00000016208   Transcript: ENSCAFT00000025730
Sequence length 1160
Comment pep:known_by_projection chromosome:CanFam3.1:3:74079102:74306767:-1 gene:ENSCAFG00000016208 transcript:ENSCAFT00000025730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHAFPNEVSVDFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSAQASRKEPG
TRQVRLCVSPSGLRCEPEPGKSQQWDPLLCSSIFECKPQHVHKLIHNSHDPSYFACLIKD
NAASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAEFALVAQNPEAPLGNGEQARRPMRKSFSQPG
LRSLAFKKELHDGSLRSSSFFSSFEESDIENHLVGGHNIVQPTDIEDNRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKSRPRSEQRENELIISFLRCLYEEKQKVHIHIGEIKQTSQIAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSMSSTLSN
MSKEPSVCEKEALPASESSFRLLGSSDDLSSDSESHPAEEPAPLSPQQSFRRRANTLSHV
PVESQEPPEPARGSPGVSQRKFMRYHSVSTETPHDQKDFDSKAEHLGDANGTPVKTRRHS
WRQQIFLRVATPQKACESPSRYEDYSELGEHPPRSPLEPVCEDGPSGPVPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLKASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHLRGEIWKFLAEQYRLRHQFPSKQQPKDTPYKELLKR
LTSQQHAILIDLGRTFPTHPYFSTQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMGEEEAFNMLKFLMFEMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVMFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTISQVFEMDISKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATVEKLLTSESKLKQAALALELERSALL
QTVEELRRQVTAEPRGLEPD
Download sequence
Identical sequences F1Q0K0
ENSCAFP00000023896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]