SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000024462 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000024462
Domain Number 1 Region: 903-1098
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.000033
Further Details:      
 
Domain Number 2 Region: 691-824
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0000338
Further Details:      
 
Domain Number 3 Region: 19-58,89-157
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000024462   Gene: ENSCAFG00000016627   Transcript: ENSCAFT00000026340
Sequence length 1141
Comment pep:known_by_projection chromosome:CanFam3.1:9:23689732:23753299:-1 gene:ENSCAFG00000016627 transcript:ENSCAFT00000026340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPGRPLPWQGPRTLLLHKSLQDGFGFTLRH
FIVYPPESAVHCSLKVHPTCPLPSGPSPRHHRLEPMDTIFVKNVKDDGPAHRAGLRTGDR
LVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEA
RSIPEPPPICYPRKTYAPPARVSTWATMVPEPLSALPSDPRSPAAWSDPGPRVPSTTRSH
LDNSSSGMSQPRPSPGAFPRLPPEPRMPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRR
AGERRCPAMPPRARSASQDRLEEVTAHHPWPCSTSQGALSQLGQEGWHRARSDDYLSRAT
RSAEALGPGALVSPRFERCGWASQRPSAHTSACPPRDLPAPQAPPPPGLQGLDDIGYIGY
RSYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPASFPPEASEPPRVVRPEPGTRALE
PPTEDRRDEVVLRQKPPTGRKVQLPPARQMNLGFGEESPEPETSGRVERLGKKMAPLATT
EDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALGRHYSQ
DCSSIKAGRRSSYLLAITTERSKSCDDGLNTFREEGRALRRLPNRVPSLRMLRSFFTDGS
LDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQVLTKKGKKAGGGLRQWKRVY
AALRARSLSLSKERREPGPAAAGAAAAVAGEDEAAPVCIGSCLVDISYSETKRRHVFRLT
TADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSAPK
ADSSPKISRGLGGLKSEFLKQSAARGLRTQDQPAGNKDDSAATPKTPWGINIIKKNKKAA
PRAFGVRLEECQPAIENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNR
GPGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRK
LIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMADMVTHM
PDRYKIVETLIQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDPGSG
E
Download sequence
Identical sequences F1P8A3
ENSCAFP00000024462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]