SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027247 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027247
Domain Number 1 Region: 11-143
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 7.32e-24
Family CSE2-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027247   Gene: ENSCAFG00000018452   Transcript: ENSCAFT00000029301
Sequence length 147
Comment pep:known_by_projection chromosome:CanFam3.1:5:41969767:41983073:-1 gene:ENSCAFG00000018452 transcript:ENSCAFT00000029301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAGVAAGRQAEDALPPPAEPSLPETKPLPPSQPPPPVAVPQPQQSPATRPQSPAGVKE
EENYSFLPLVHNIIKCMDKDSPDIHQDLNALKTKFQEMRKVISSMPGIHLSPEQQQQQLQ
SLREQVRTKNELLQKYKSLCMFEIPKE
Download sequence
Identical sequences E2RE33
ENSCAFP00000027247 XP_851901.1.84170 ENSCAFP00000027247 9615.ENSCAFP00000027247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]