SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027305 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027305
Domain Number 1 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 2 Region: 44-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027305   Gene: ENSCAFG00000018493   Transcript: ENSCAFT00000029364
Sequence length 258
Comment pep:known_by_projection chromosome:CanFam3.1:20:52886376:52890342:-1 gene:ENSCAFG00000018493 transcript:ENSCAFT00000029364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGGVRRPAALELALRLLLGFGLGLEAAPTPVPLRLLAQAPGSCPPASFQCRTSGFCVP
LTLRCDGDEDCPDGSDEDECRIKPCAQDGECLPVTGSPCPCDNIDDCRDGIVDNVYNCSY
QPCPAGELRCLRGGACIPHTWLCDGHGDCPGSSDELGCGTETLQDKAATSIGTSVTPDDV
TSLWNATAIPVEDQDSVQAGNRSACGVIAAAVVLSVGVAAISLFVMSRLRAQGRLYPQGL
LMVMKESLLLSERESTLL
Download sequence
Identical sequences F1PLL4
ENSCAFP00000027305 XP_003639780.1.84170 ENSCAFP00000027305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]