SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027333 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027333
Domain Number 1 Region: 299-395
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-24
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000193
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027333   Gene: ENSCAFG00000018501   Transcript: ENSCAFT00000029398
Sequence length 931
Comment pep:known chromosome:CanFam3.1:5:42227758:42338668:-1 gene:ENSCAFG00000018501 transcript:ENSCAFT00000029398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIISGWLEMLMVY
PRTNKQNQKKKRKVEPPTPQEPGPAKMAVTSSSSSSSIPSAEKVPTTKSTLWQEEMRAKD
QPDGGSLSPAQSPSQSQPPAASTLREPGLESKDEESTMSSDRMDCGRKVRVESGYFSLEK
TKQDLKAEEQQLPPPLSPPSPSTPNNRRSQVIEKFEALDIEKAEHMETNSSSGPSPSSDT
RQGRSEKRAFPRKRDLPNEAPTAPLPDTSATPMSPHRRAKSLDRRSTESSLTPDLLNFKK
GWLTKQYEDGQWKKHWFVLADQSLRYYRDSAAEEAADLDGEIDLSTCYDVTEYPVQRNYG
FQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTSAPDVTSSLPEEKNRSSSSFETCPRP
SEKPDMERGEPDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERASTTGISDTHPE
AEAGELERERARRREERRKRFGMLDATDGPGADDTALRMEVDRSPGLPVTTDLKTQNVHV
EIEQRWHQVETTPLREEKQVPIAPLHLSSEDGGDRLSTHELTSLLEKELEQSQKEASDLL
EQNRLLQDQLRVALGREQSAREGYVLQATCERGFAAMEETHQKKIEDLQRQHQRELEKLR
EEKDRLLAEETAATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQ
SVQRELEVLSEQYSQKCLENAHLAQALEAERQALRQCQRENQELNAHNQELNNRLAAEIA
RLRTLLTGDAGGEATGSPLTQGKDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDK
KYASDKYKDIYTELSIVRAKADCDISRLKEQLKAATEALGEKSPENTPVSGYDIMKSKSN
PDFLKKDRSCVSRQLRNIRSKSVIEQVSWDN
Download sequence
Identical sequences F1PLJ6
ENSCAFP00000027333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]