SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000027740 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000027740
Domain Number 1 Region: 1066-1160
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-23
Family I set domains 0.004
Further Details:      
 
Domain Number 2 Region: 778-871
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-23
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 874-968
Classification Level Classification E-value
Superfamily Immunoglobulin 5.68e-23
Family I set domains 0.0061
Further Details:      
 
Domain Number 4 Region: 970-1064
Classification Level Classification E-value
Superfamily Immunoglobulin 1.73e-19
Family I set domains 0.002
Further Details:      
 
Domain Number 5 Region: 323-417
Classification Level Classification E-value
Superfamily Immunoglobulin 4.48e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 1162-1249
Classification Level Classification E-value
Superfamily Immunoglobulin 6.92e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 7 Region: 132-226
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-18
Family I set domains 0.0097
Further Details:      
 
Domain Number 8 Region: 685-775
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-17
Family I set domains 0.0069
Further Details:      
 
Domain Number 9 Region: 39-128
Classification Level Classification E-value
Superfamily Immunoglobulin 7.84e-16
Family I set domains 0.0046
Further Details:      
 
Domain Number 10 Region: 227-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000103
Family I set domains 0.0095
Further Details:      
 
Domain Number 11 Region: 591-682
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000319
Family I set domains 0.0045
Further Details:      
 
Domain Number 12 Region: 420-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000111
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000027740   Gene: ENSCAFG00000018799   Transcript: ENSCAFT00000029848
Sequence length 1338
Comment pep:known_by_projection chromosome:CanFam3.1:X:102359983:102373889:-1 gene:ENSCAFG00000018799 transcript:ENSCAFT00000029848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLNRLGERAAMLWTFTVLLFCIRLSLGMTSIGMTVMQSQPELWIETNYPQTPWENITLW
CKSPSRISSKFLLLKDKTQMTWIRPSSKTFQVSFPIGALTKSNAGLYRCCYWKETGWSEP
SKVLELEAPGQLPKPIFWIQAETYPLTGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQIP
TGTVAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGPI
MAPGESLNLRCQAPIYGMTFALIRLEDLKKSFYRKRPIKNEAYFFFRALKIHDAGHYLCF
YYDESYRGSLLSDILKIWVTDTFPKTWLLAQPSPVVQMGQNVSLWCRGPVDGVGLALYKK
GEDKPLQLLDTTSIDDESFFLNNVTYSDAGIYSCHYLLSWKTSIRMTSHNTVELVVVDKP
PKPSLSAWPSTMFKLRKAITLQHRVPHPVLEFSLEWEERATFQKFLVDGDFIISNAEGKG
TETYSCSYRIEAHPNIWSDRSEPLKLMGPAGFLTWNYILNEAIRLSLIMQLVALLLVVLW
IRWKCRRLRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLTEETEIIMPTPKPELWAET
NFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSY
HCHSWEEMAVSEPSEALELVGTDILPKPVISASPPIRGQKLQIRCKGWLAGMEFVLYKEG
VQEPVQQLHAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSDPMELVIKEMYPK
PFFKTWASPVVTPGARVTFNCSTPQQHMSFILYKDGSEIASSDRSWASPGASAAHFLIIS
VGTGDGGNYSCRYYDFAIWSEPSDPVELVVTEFYPKPTLLAHPGPVVLPGKNVTLRCQGA
FQGMRFALLQEGTQVPLQFQSTSGNSADFLLHTVRAEDSGNYSCVYYETTMSNRGSHLSK
PIMIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCQGPVHGVGYILHKERETTSVQLWGSTS
NDGAFPITNISGANIGRYSCCYHPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPIVA
PGENMTFQCQGELPDSTFVLLKEGTQQPLEQQSPSGYRADFWMPAVRGDDSGVYSCVYYL
DSAPFAASNHSDFLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDG
EEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDALELVGAAGPAAQECT
VGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRDSETDGRDQTIALEECNQEGEPATNT
SSPSSVSQGTSVELPVPV
Download sequence
Identical sequences F1PPN9
ENSCAFP00000027740 ENSCAFP00000027740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]