SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028483 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028483
Domain Number 1 Region: 427-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 118-170
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000248
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 
Domain Number 6 Region: 389-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000406
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028483   Gene: ENSCAFG00000023869   Transcript: ENSCAFT00000030646
Sequence length 550
Comment pep:known_by_projection chromosome:CanFam3.1:6:38085231:38093675:-1 gene:ENSCAFG00000023869 transcript:ENSCAFT00000030646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADGRGTRATQDKERAREVPGHGHPCQEMLSESEETVPLGAAWDSPHIKMEPEEPHPEG
ALQGDGVPGVPSWVSLSQGSKEKTLFLPSGALPSPQIPVLSREERTRDRQMAAALLSAWS
QMPVTFEDVALYLSREEWGRLDHTQQSFYRDVLQKRNGLALGFPFSRPFWTSQGQGKGEA
SSSCQQMGDEEEEKTGVIEVGKEEPAPSLAAFGEVKSFRSRVGKAQGDVLQCGQQVGSGQ
SSGPAKDDGQPGPPEERQAKPAPPDTSLTKAQEGRLPEKPREGWTGTPESSEEGLTPDGD
TNKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTGEK
PYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKC
PICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCG
KSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAG
ALAAPPPAPT
Download sequence
Identical sequences E2QY38
ENSCAFP00000028483 ENSCAFP00000028483 XP_005621704.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]