SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028490 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028490
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-38
Family SCAN domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 6 Region: 513-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000307
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 211-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000275
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000835
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028490   Gene: ENSCAFG00000019292   Transcript: ENSCAFT00000030654
Sequence length 684
Comment pep:known_by_projection chromosome:CanFam3.1:6:37942782:37948607:-1 gene:ENSCAFG00000019292 transcript:ENSCAFT00000030654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPGPQDREGLLIVKLEEDCAWSQELPPSDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHEWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRLQVTNHRRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPK
RDPQAVKERALSAPWLSLFPAEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESQVPRQEALSTQVERGGKPWDPSLQTCKEGLSPRSPAPGEEKF
ENQEEGAQSVSPESIRPQALLPGQARGEVPWSPEQGRPQDRADGHWEPPPEEGMEPSLVG
ATSCRELGRPKDLQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECGEIFGGNP
HFLSLHRTHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERT
HEKERLYPFSECGEAVSDSTLFLTNHGTHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCNLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F1PX38
ENSCAFP00000028490 XP_547160.2.84170 ENSCAFP00000028490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]