SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000028594 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000028594
Domain Number 1 Region: 63-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-86
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 338-358,433-554
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-45
Family Pleckstrin-homology domain (PH domain) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000028594   Gene: ENSCAFG00000019358   Transcript: ENSCAFT00000030760
Sequence length 558
Comment pep:known_by_projection chromosome:CanFam3.1:6:38431802:38471005:-1 gene:ENSCAFG00000019358 transcript:ENSCAFT00000030760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDQVVSRLYDTVPIQSSVVLCSCPSPSMVRTQTESGTAPGIPSGGSRQAPTMDSTAAESR
PSTNSLQHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYSPLRAHPFFESITWENLQHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDAGLPQMAGSNIEQYIHD
LDTNSFELDLEFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
Download sequence
Identical sequences F1Q2Y3
ENSCAFP00000028594 9615.ENSCAFP00000028594 ENSCAFP00000028594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]