SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029273 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029273
Domain Number 1 Region: 853-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000693
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 623-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000863
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 744-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000127
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 4 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 798-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000392
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 566-626
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 691-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000746
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029273   Gene: ENSCAFG00000023757   Transcript: ENSCAFT00000031449
Sequence length 955
Comment pep:known chromosome:CanFam3.1:9:49925423:49959981:1 gene:ENSCAFG00000023757 transcript:ENSCAFT00000031449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGQRQPSRWVWALLAVVLLAGGVASTGATDNSPTSNSLEGGTDATAYWWGEWTKWTACS
RSCGAGVTSQERHCLQQRRTSVMGAGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCISF
NSRVYDGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYYFFNGNFKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHTHRIQPVYYSFSEPTSESAESQELD
GAALLGFLQHNTSFYSQASSERLGLDNRLFGHLGPGIELGLSKGQETNEVCEQAGGRACE
GPPRGKGFRDGNATGTALTGDKDEQQVDKRLTSQRLLSANVISDQLLGAGSDSRELPFNE
TGNSIFAQGAPRRSPAESLYVDYEENEEAGAYLLNGSYLELSSDRVTNSSSEAPFPNASS
SLPALAGNRTHKARTRPKTRKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRYDG
IEVDDSYCDALTRPEPVQEFCAGRECQPRWETSSWSECSRTCGEGYQFRIVRCWKMLSPG
FDSSVYSDLCEAAEAVRPEEHKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSED
EKLCDPNTRPVGEKDCTGPPCDRQWTVSDWGPCSGSCGQGRMIRHVYCKTSDGRVVPESQ
CQMETKPLAIHPCGDRNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPE
CGLAKKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKP
VGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences F1PBN7
ENSCAFP00000029273 ENSCAFP00000029273 XP_003639356.1.84170 XP_013972430.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]