SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000029487 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000029487
Domain Number 1 Region: 98-216
Classification Level Classification E-value
Superfamily PX domain 2.4e-16
Family PX domain 0.0031
Further Details:      
 
Domain Number 2 Region: 299-353
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 900-929
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000698
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000029487   Gene: ENSCAFG00000019907   Transcript: ENSCAFT00000031673
Sequence length 953
Comment pep:known_by_projection chromosome:CanFam3.1:5:65610958:65664202:1 gene:ENSCAFG00000019907 transcript:ENSCAFT00000031673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGGHGGGGHSGGKSALPTCPACHKVTPRT
EAPVSSVSNSLENALHTSAHSTEESLPKRTVGKHSKVSVEKIDLKGLSHKKNERHVECSF
EVLWSDSSVTSVTKSSSEVTEFISKLPQLYPEENLEKFIPCLAGPDSFYVERNHMDLEAD
LRYLASLPSHLLKNDHVKRFFSTSSPTQQLQSPSPGTPSLSKVGTMMGVSGRPVCGVAGI
PSSQSGAQHHMQHSASAATLPHCSHTGGTGSALAYRAQMDTSPAILMPSSLQTPQTQEQN
GILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSE
KRCLNPAAPPPVTSSGVARVPPTSHVGPVQTVRGTHAAALRVEVEQAPHQTAREGSSSEC
SSSSPSPMGVQGREESSDSAEENDRRVEIHLEGSDKEKPVMLLNHFASSSARPTAQVLPV
QNEAGSSPSGHHPLPPQMMAAASHLAPIRMLNSVHKSERGGADMKLLPPSVHSLLSLEER
SKLSGPRGGIKVDKNFGHAVIDAAPAPTPQQPLQVLSALAESSSVSPSVSFGPRAKVVHT
SALDRVMKPAPQSALAAESSTAAAGTSSTVFHVARPPIKLLVSSSVPADSAISGQTPCSN
NVQISVPPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTASSSSHPSTSFAS
MATVPSCPAPSSSPALSSAPESSFYSSSGGGGGGGSPGNIPASTQNHHHHHHHQQPSAPQ
QPTPAPPPGCVVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFPFPFLPFSPVCGSGY
VGAQQYGGGAFPVVHSPYGGSVPPEPVLGGQSAFTVPPMQSFMAGAAGVYQAPGLVGSSN
GTGHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences E2QSI9
ENSCAFP00000029487 9615.ENSCAFP00000029487 XP_005620644.1.84170 ENSCAFP00000029487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]