SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000030846 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000030846
Domain Number 1 Region: 251-325
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000432
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 49-124
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000118
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 886-965
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000471
Family Carboxypeptidase regulatory domain 0.036
Further Details:      
 
Domain Number 4 Region: 805-876
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000122
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000030846
Domain Number - Region: 364-416
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000902
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 137-220
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00216
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 732-790
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000030846   Gene: ENSCAFG00000018181   Transcript: ENSCAFT00000035572
Sequence length 1144
Comment pep:known chromosome:CanFam3.1:6:27738472:27793516:-1 gene:ENSCAFG00000018181 transcript:ENSCAFT00000035572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLYDKGDFILKIEPPLGWSFEPTIVELYVDGVSDICTKGGDIDFVFTGFSVNGKVLSK
GQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTT
VRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSVVSKEDVLGCNISPVPGF
QPPDESLVYLCYAVSKEDGSFSFYSLPSGDYTVIPFYRGERITFDVAPSRRDFAVEHDSL
KIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIH
AQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMSKYKVVLSSQDK
DKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTDRPVMDVAF
VQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGRVNSMTFTFDTVLPGKYKIS
IMHEDWCWKNKSLEVEVLEEDVSTIEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYN
LSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKML
DVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIESRRQEREKSGKEDAGEGRTKPPV
QEMVEELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESCPGKLIEIHGK
AGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDRGAYSVGPLHSDLEYTVSSQKEGY
VLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLTQDNGILTFSN
LSPGQYYFKPMMKEFRFEPSSQMIEVQEGQSLKITVTGYRTAYSCYGTVSSLNGEPEQGV
AVEAVGQDDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIVV
GNNDIDDVSIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFF
HFPPLLRDGQNYVVLLDSTLPRSQYDYVLPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQ
GSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQTASDNSGPEDAKRQAKKQK
TRRT
Download sequence
Identical sequences F1Q342
ENSCAFP00000030846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]