SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000031095 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000031095
Domain Number 1 Region: 370-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000253
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 407-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000848
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000458
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000178
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000031095   Gene: ENSCAFG00000023314   Transcript: ENSCAFT00000035796
Sequence length 505
Comment pep:known_by_projection chromosome:CanFam3.1:12:57803068:57810748:1 gene:ENSCAFG00000023314 transcript:ENSCAFT00000035796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCGLSSGGGGRAYLHPEHAARQ
GAADGLPFSPRPPAPDFAAAAPAGTLRPPPHAPSPLQACGAREGIKREEFFVVLGFSVAK
MVGECYVKIGKYIIYGNNGDRLKNMFYYYAQMSLYRLAFTRILFWNSRPQHLSHLSTAAA
AAALSPAELGSLAGIDRELAMHAQQLSGLAAGKSRGRLDPGALAPAVVAAGGAGGGGGAG
GGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLH
AEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQNLLAKAADGPGAGPDYLPEPGEPKSDN
DSDVDVCFTDDQSDPEAGGGGQRHA
Download sequence
Identical sequences F6Y0B8
ENSCAFP00000031095 ENSCAFP00000031095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]