SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000032340 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000032340
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.075
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000032340
Domain Number - Region: 287-382
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number - Region: 178-269
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0575
Family Oxygen-evolving enhancer protein 3, 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000032340   Gene: ENSCAFG00000023745   Transcript: ENSCAFT00000036912
Sequence length 422
Comment pep:known_by_projection chromosome:CanFam3.1:8:43280008:43306403:1 gene:ENSCAFG00000023745 transcript:ENSCAFT00000036912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSKSNSVSPSPSLEQAESDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLL
YYSESEKKNFETNKYFNIHPKGVIPLGGCLVEAKEEPSMPYAMKISHQDFHGNILLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELKMEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQQTLEELSIEKKKTLAMLEENENQLQTLANQSEQPPPSGGLHSNLRQIEEKMQQLLE
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAERELKAEVKVRMD
LERRLREAEGALRSLEQGLNSKVRNKEKEERMRADVSHLKSKPCPRXXXXXXXXXXXXXX
XX
Download sequence
Identical sequences F1PNM5
ENSCAFP00000032340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]