SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000033373 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000033373
Domain Number 1 Region: 671-852
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-65
Family SPRY domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-25
Family Pyrin domain, PYD 0.0033
Further Details:      
 
Domain Number 3 Region: 443-508
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.97e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000033373   Gene: ENSCAFG00000024473   Transcript: ENSCAFT00000037775
Sequence length 858
Comment pep:novel chromosome:CanFam3.1:6:37970548:37983737:1 gene:ENSCAFG00000024473 transcript:ENSCAFT00000037775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTPSDHLLDSLEELLPNDFEKFKFKLQNTSVEKDHSRIPRGQVQNAKPVKLANLMINH
YGEENAVRLTLQVLRAINQNLLAEELDKAIGPEYLIQESGTYSSAMSCSFGENKSKGLKI
SDGLEGERQRQSGDGAVSLPANQHEAGKGSQKKPQSRRRDQKSSGCPDMLGKPGARSLSS
SSKRSPFPGKLQGEKGSPTDHLRWNASSLGLQELSSGSFTGSLGRVKSKIPGERLSSGQR
RPRSLEFTIFSRERELLNPETLLSQEKMRSDHTDSAATPSEVATLDVGATVAPEKGSRNP
EHSMIPKEGAFRKTLSNVSLSKGKTTCEHPESIGPSKKNGIEGQEPPETSREVAGGELHQ
PSGPEVPPSSGKPQDEAMYPLGHAQEGDPADGTYVHDSYRPAIGSEDLKTSGRYSPSCLS
SQASLPIKNSGDVQQKEDLQMAILSPRSLPQCERHMKQVQLLFCEDDREPICLICSLSQE
HRGHRVRPIEEAALEYKVKIQKQLEYVKELRKSGEEQRSQGDKKTAKFLKQMETQKQRIQ
HQIEQLYHILEQQEKFFVASFEDLNRTIGQVRETYSTQVSRDIALLDELIGELEAKQFQP
EWELMQDIGVTLHRVKMVTVPKLWNTPLEVEKKIQLFYRKSEFVEKSMKYLSEMLRSEID
IFNVPELICAQAHAANVILDAETAHPNLIFSNNLKSVRLGNKWNRLPDNPERFDSCIIAL
GLPSFFSGRHYWEVEVGNKTGWILGICKASMSRKGSMTLSPDNGYWVVIMMKRSEYQVST
IPPTRLQLREPPKRVGIFLDYKAGDISFYNVTNKSLIYAFTGFSSSEPLQPIFSPGTHDG
GKNMDPLTICPVGDQEPH
Download sequence
Identical sequences F1PEK8
ENSCAFP00000033373 ENSCAFP00000033373 XP_547161.4.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]