SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000035786 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000035786
Domain Number 1 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000017
Family Somatomedin B domain 0.0048
Further Details:      
 
Domain Number 2 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000035786   Gene: ENSCAFG00000008004   Transcript: ENSCAFT00000039873
Sequence length 264
Comment pep:known_by_projection chromosome:CanFam3.1:29:21712267:21737444:-1 gene:ENSCAFG00000008004 transcript:ENSCAFT00000039873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLWMALCALARLWPGSLAGCADAGRCCPGRDAACSARGWRLDRVYGTCYCDQACRRTG
DCCFDYARACPARPCIVGEWSPWSGCGDQCRPAALVRRRPVQQEPRNGGAPCPPLEERAG
CLDYSTPRGQDCGRAFVPAFITTSAFNKERTRQAASPQWSTDTEDAGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVDCQRPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences E2R4R5
ENSCAFP00000035786 ENSCAFP00000035786 XP_005638100.1.84170 XP_005638101.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]