SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036525 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036525
Domain Number 1 Region: 302-469,549-717
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.5e-127
Family Mammalian PLC 0.00000077
Further Details:      
 
Domain Number 2 Region: 144-301
Classification Level Classification E-value
Superfamily EF-hand 1.3e-42
Family EF-hand modules in multidomain proteins 0.03
Further Details:      
 
Domain Number 3 Region: 735-851
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-27
Family PLC-like (P variant) 0.00061
Further Details:      
 
Domain Number 4 Region: 18-130
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-26
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036525   Gene: ENSCAFG00000019405   Transcript: ENSCAFT00000047332
Sequence length 1020
Comment pep:known_by_projection chromosome:CanFam3.1:5:57148074:57367266:1 gene:ENSCAFG00000019405 transcript:ENSCAFT00000047332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVGGTELLASEAQLGPLLEGCMSAMQAGTQMVKLRGSSKGLVRFYFLDEHRSCIRWRPSR
KNEKAKISIDSIQEVSEGRQSEIFQRYPDGIFDPNCCFSIYHGSHRESLDLVSPSGDEAR
TWVTGLRYLMAGIRDEDSLARRQRTRDQWLKQTFDEADKNGDGSLSIGEVLQLLHKLNVN
LPRQRVKQMFKEADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLTYSDHKDHLNATDLQ
RFLEVEQKMAGVTLESCRDIIEQFEPCPENKSKGVLGIDGFTNYTRSPAGDIFNPEHHGV
HQDMTRPLSHYFITSSHNTYLVGDQLMSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIV
HHGYTLTSKILFRDVIETINKYAFVKNEYPVILSIENHCSVIQQKKMAQYLTDILGDKLD
VSSVSSDDATLLPSPQMLKGKILVKGKKLPANISEDAEEGEVSDEDSADEIDEDCKLLNG
DVATNRKRVENIAKKKLDSLMKESKIRDCEDPNDFTVSTLPPSGKLGYKAEAEEDVESGE
DAGVSRRNNRILMSGFSKRKKKSSKLKKAASMEEGDEDLDSQGSQSRGASRQKKTMKLSR
ALSDLVKYTKSVGTHDVEAEVASSWQVSSFSETRAQQILQQKPAQYLRFNQHQLSRIYPS
SYRVDSSNYNPQPFWNAGCQMVALNYQSEGRMLQLNRAKFSANGNCGYVLKPQCMCQGVF
NPNSEDPLPGQLKKQLVLRIISGQQLPKPRDSMLGDRGEIIDPFVEVEVIGLPVDCNREQ
TRVVDDNGFNPMWEETLVFTVHMPEIALVRFLVWDHDPIGRDFIGQRTLAFSSMMPGYRH
VYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLRGTKPGSLDSHAAGRPLPRPSVSQR
LLRRTASAPTKSQKPSRKAFPELVLGTQDTGSEGEARDVAAPSPGPVLEASAPEEPGSRS
PRDTRPFSMQRTGSSLCGLETIAEEPALGPGPPPLVAAPPSPSPGGPLCASGPGTKVTSP
Download sequence
Identical sequences J9NTP0
ENSCAFP00000036525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]