SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000036835 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000036835
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily Cyclin-like 1.47e-23
Family Cyclin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000036835   Gene: ENSCAFG00000030355   Transcript: ENSCAFT00000047423
Sequence length 271
Comment pep:known_by_projection chromosome:CanFam3.1:1:113413347:113417269:1 gene:ENSCAFG00000030355 transcript:ENSCAFT00000047423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPGSRLPALSGADPRPSPLQSPAASPDRIPDGPRGSPGRREGPRGPCAPPGLAEALSA
LGLEGEREYAGDIFTEVMVCRALPRRALPPTVTPEMRALVVDWLIQVHEYLGLAGDTLYL
AVHLLDSYLRAGRVRLHRLQLLGVACLFVACKVEECVLPEVLPGWGREGGTRARRGTGGR
PTARRASALRALGIPACVRGRGCSQRVPVTEGETEAQSSWGLDRGLNSSSRCSASLESVP
NGSSPGFPFYGRGSSVSVCDVPVTRWEIGRG
Download sequence
Identical sequences J9NUJ6
ENSCAFP00000036835 ENSCAFP00000036835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]