SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037446 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037446
Domain Number 1 Region: 1200-1304,1358-1494
Classification Level Classification E-value
Superfamily Cullin homology domain 4.97e-39
Family Cullin homology domain 0.0009
Further Details:      
 
Domain Number 2 Region: 763-955
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.34e-36
Family APC10-like 0.007
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.12e-32
Family CPH domain 0.00000797
Further Details:      
 
Domain Number 4 Region: 119-218,473-562,623-750,800-816
Classification Level Classification E-value
Superfamily ARM repeat 0.000000276
Family PBS lyase HEAT-like repeat 0.065
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000037446
Domain Number - Region: 1535-1631
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00633
Family SCF ubiquitin ligase complex WHB domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037446   Gene: ENSCAFG00000001774   Transcript: ENSCAFT00000049857
Sequence length 1683
Comment pep:known_by_projection chromosome:CanFam3.1:12:11555419:11574485:-1 gene:ENSCAFG00000001774 transcript:ENSCAFT00000049857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGEGGSSQVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQEITGEAGALDKSVLGEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRLLFSLVKRYLHVTSLLDQLNDSAAEPGAQNNSGPEELSGERDRLELEFSMAM
GTLISELVQAMRWDWALSRQRPLARSSCSIFQPQLAEAGPGLPPTRAQPSIRRSRRFRPR
SEFASGNTYALYVRETLQAGMRVRMLDDYEEVSAGDEGEFRQSNNGMPPVQVLWESTGRT
YWVHWHMLEILGFEEDIEDVVEANEYQGAVVSGALGVALPSWRWKPMTELYAVPYVLPED
EDAEESEHLTQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPMELA
QDLLLALPQRLDDSALRDLLNCRVYRKYGPEALAGHPAYPTLLEAQAQPQESAGKEPPAQ
YPDTPLWRLLVDCGPPGRTFLDLERALSSEGPQETEIKPFLLQLQRQPQPFLILMQSLAT
PAANKPLHLTVLRILMQLVDFPEALLLPWHEAMDACMACLRSPDTDREVLQELIFFLHRL
ASVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKLTTNILG
GCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSMEVKEDKCWEKVEVSSNPHRASK
LTDRNPKTYWESSGSAGSHYITLHMHQGILIRQLTLLVAGEDSSYMPARVVVFGGDSTNS
LNTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTRIRGLEVLGPKPTFWP
VFREQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFADRFLPDDEAA
QALGKTCWEALVSPLVQNITSPDEDGISPLGWLLDQYLECREAAHNPQSRAAAFSSRVRR
LTHLLVHVEPCEAPLPAAAAPRTKSRNRSHDWSSLATRGLPSSIVRNLTRCWQAVVEEQV
NNFLTSHWRDDDFVPRYCEHFHNLQKSSSELFGPRAAFLLALQNGCAGGLLKLPFLKAAH
VSEQFARHIDQRIQGSRIGGARGMEMLAQLQRCLETVLIFSGLEIATTFEHYYQHYMADR
LLGVGSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSEELQRQFHVYQLQRLDQELLKLED
TEKKIQGGHETSDKEHKGEKAEEAEGAVVTNVVEEEEEEEENEDLYYEGAMPEVSVLVLS
PRCWPIASICHTLNPRTCLPSYLRGTLNRYSNFYSKSQSYPALEQGPKRRLQWTWLGRAE
LQFGDQTLHVSTVQMWLLLYLNDLQAVSVESLLALSGLSPDMLNQAITPLTSLRGPLDLR
EENDVPGGVLKIRDASEEPRPRRGNVWLIPPQVYLKAEDEEGRNLEKRRNLLNCLIVRIL
KAHGDKGLHIDQLVCRVLDAWQKGPCPPRGLVSSLGRGSACNSTDVLSCILHLLGKGTVR
RHDDQPQMLSYAVPMTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTGTQSFS
TFR
Download sequence
Identical sequences J9NWA1
XP_005627437.1.84170 ENSCAFP00000037446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]