SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000037846 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000037846
Domain Number 1 Region: 120-181
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 750-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.9e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 638-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 696-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 792-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 417-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000477
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000149
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000037846   Gene: ENSCAFG00000029776   Transcript: ENSCAFT00000043129
Sequence length 853
Comment pep:known_by_projection chromosome:CanFam3.1:1:99893640:99914350:1 gene:ENSCAFG00000029776 transcript:ENSCAFT00000043129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRSLLLFLWIGCLFCYWFFFRERTTFVFSIFVVRLVLQLHSVNESPESSAPGRAPGPL
ICGMAAINPWASWGILTDQSWGMAAVDPWASWALCPQDSAWHLEENREEEKRATGLPTAE
VQEPVTFKDVAVDFTQEEWGQLDPVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQG
EEPWSVEQAYPQSTCSEWMRNLESKALIPTQSIFEEEQSHRMKLERYIWDDPWFSRLEVL
GCKDQLEMYHMNQSTAMRQMFFMQKQVLSQRGSEFCELGAECSQNLNFVPSQRVSQIEHF
YKPDTNAESWQCNSIMYADKITCGSHDYDKAFHQSIQPIQPERIQTEDNLLKCADAVKSF
NHFLHFGDHKGMHTGEKLYEYKECHQIFNQSPSFNEHPRLHIGENQYDYKEYENIFYFSS
FMEHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTSEKPYEYNECGTSFIWSSYLIQH
KKTHTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIH
TGEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEK
PFKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNC
QECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCG
KSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFN
ESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNDCGKAFSGHSA
LLQHQRNHSEEKL
Download sequence
Identical sequences J9NX34
XP_013969905.1.84170 ENSCAFP00000037846 ENSCAFP00000037846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]