SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038035 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038035
Domain Number 1 Region: 99-282
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.04e-77
Family F-box associated region, FBA 0.00000124
Further Details:      
 
Domain Number 2 Region: 37-116
Classification Level Classification E-value
Superfamily F-box domain 5.1e-17
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038035   Gene: ENSCAFG00000029614   Transcript: ENSCAFT00000049774
Sequence length 315
Comment pep:known_by_projection chromosome:CanFam3.1:2:84545930:84555011:-1 gene:ENSCAFG00000029614 transcript:ENSCAFT00000049774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPWVLRPRSRVGVITSCPHRPVCAPPAPAMALVSINELPESILLEVFTHIPARQLLLR
CRPVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKIFFFLCSLRRNLLRNPCAEE
DMKSWQIDCNGGDEWKVESLPGDHGTDFPDSKVKKYFVTSYEMCLKSQLVDLKAEGYWEE
LLDTVRPEIVVKDWFAARADCGCTYHIRVQLASADYIVLASFEPPPVTVDQWNSAKWTEV
SHTFSDYPPGVRHILFQHGGQDTQFWAGWYGPRVTNSSIVIGPKVTGDPARFPAQPEHTQ
GRERAARLPSSLHLH
Download sequence
Identical sequences J9NXM2
XP_005618058.1.84170 ENSCAFP00000038035 ENSCAFP00000038035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]