SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000038473 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000038473
Domain Number 1 Region: 90-126
Classification Level Classification E-value
Superfamily F-box domain 0.0000000102
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000038473   Gene: ENSCAFG00000008297   Transcript: ENSCAFT00000049311
Sequence length 203
Comment pep:novel chromosome:CanFam3.1:25:29079227:29112733:1 gene:ENSCAFG00000008297 transcript:ENSCAFT00000049311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEKGSIDGDWTTGRKGGGWTESKKKLPWQHQRLRLEEGGELKEVFEERRALLGKWFDKW
TDSQRRRILTGLLERCSLSQQKFCCQKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSL
CRCAQTPPKDGFSIANVQPVTSRSPGEKQSPASAFRSSSSLRKKTHAAEKELPPWRSSDK
HPTDIIRFNYLDNCDPIEQIWQG
Download sequence
Identical sequences J9NYV3
ENSCAFP00000038473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]