SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039158 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039158
Domain Number 1 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-21
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 4 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 6 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000735
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 528-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000398
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 127-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000158
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039158   Gene: ENSCAFG00000031469   Transcript: ENSCAFT00000049840
Sequence length 668
Comment pep:known_by_projection chromosome:CanFam3.1:20:56209815:56233817:1 gene:ENSCAFG00000031469 transcript:ENSCAFT00000049840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEDVAVYFTPEEWALLDRGQRRLYRDVMLETCRNLAAVDCCTQVKPCGSRTQLNI
LESELSSEEKIVRFTRNDSWALFGENQVFHNIGDQFQSQERCLRSHLLERVCESNEGNQG
GDTVNQITGLTVHEDCPAGEKSCECAKCREVFRDGSFLENPQIFHPGHKPNPCEECGPTC
SGVLSLSTQVDADLVRKPYEHQDIGRAPKRYSNSLGSQKSLECGKCGKTFTCPSSFQGHV
QGHCEQRVHVCDVCGKTFMYQSYLTRHMRTHTGERPYECVECGKAYSCLSYFREHVKTHS
GEKLYECKQCGKTFKYPASLQGHMMTHTGERPYLCQQCGKAFSCPKYFRRHVRTHSGVKP
YECTLCGKAYSCSLSLREHVGTHSEERPYECKQCGKAFRHPRYFQRHVRMHTGVKPYECK
ECGKAYSSSTSLQEHVRTHTGERPFECQQCGKAFTRHSSLQGHVRAHSLEKRYECTQCGK
AFRWSSSLQKHVRTHSEEKPYECQQCGKAFWYPANLRAHVKTHTEDRPYECPHCGKAFSC
HSSLQVHVRKHNGVKPYECKECGKAFWYPVNLRAHVRTHTGERPYECQQCGKAYRCPANL
RVHVRTHTGERPYECQQCGKAFRYPANLRAHVRTHTGERPYECQQCGKAFRYPTNLRAHV
RTHTGEKL
Download sequence
Identical sequences J9P0T5
XP_005633146.1.84170 ENSCAFP00000039158 ENSCAFP00000039158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]