SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000039814 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000039814
Domain Number 1 Region: 39-149
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-31
Family Pleckstrin-homology domain (PH domain) 0.00000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000039814   Gene: ENSCAFG00000003268   Transcript: ENSCAFT00000043685
Sequence length 181
Comment pep:known_by_projection chromosome:CanFam3.1:10:67597798:67652032:1 gene:ENSCAFG00000003268 transcript:ENSCAFT00000043685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWDFNLKVEAGKIARSRSVMTGEQMATLHLPAPSPLQRPVKMGWLKKQRSIVK
NWQQRYFVLRAQQLCYYKDEEDGKPQGCLYLPGGTIKEIATNPEEAGKFVFEVIPASWDQ
SRTGQDSYVLMASSQAEMEEWVKFLRRVAGTPSGGKDSADVPGQVSVASQRWGVSSSRHD
R
Download sequence
Identical sequences J9P2N6
ENSCAFP00000039814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]