SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041139 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041139
Domain Number 1 Region: 552-663
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00035
Further Details:      
 
Domain Number 2 Region: 67-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.26e-28
Family G proteins 0.000000044
Further Details:      
 
Domain Number 3 Region: 342-407,492-535
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000002
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041139   Gene: ENSCAFG00000000273   Transcript: ENSCAFT00000044042
Sequence length 694
Comment pep:known_by_projection chromosome:CanFam3.1:10:1792666:1807610:-1 gene:ENSCAFG00000000273 transcript:ENSCAFT00000044042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAQRQLAGAAVRAEVRRHEVAKQSLCRLRKLAERVGDPELRNSIQASLDRLHEAVVNSQ
EWTLSRSIPELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQHKKEMLVDGQTHLVL
IREEAGAPDAKVRGWADAVILVFSLEDENSFQAVSHLHGQLTSLRGEGRGGLALALVGTQ
DRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLL
AACKSLPSSPSHSAASTPVDSFIHPQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAG
LSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLN
KEWKKKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSAS
INGLVKDMSTVQMGEGPGTKLSHAMNCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKT
EGSAGQAEDPEENLEFLIVSSTGQTGHLEAASFEERDPWVQPIESQILASLQCCESSKVK
LRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSR
VRSLDLDDWPRELTLVLTAIGNDVANRVWESDTRGRSKPTRDSSREERESWIRAKYEQLL
FLAPLGAPEEPLGRRLWAAVQAQDVAAVLLLLAH
Download sequence
Identical sequences J9P657
ENSCAFP00000041139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]