SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041236 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041236
Domain Number 1 Region: 100-143
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000017
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041236
Domain Number - Region: 9-81
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041236   Gene: ENSCAFG00000004444   Transcript: ENSCAFT00000045624
Sequence length 271
Comment pep:known_by_projection chromosome:CanFam3.1:16:14407208:14426998:-1 gene:ENSCAFG00000004444 transcript:ENSCAFT00000045624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLG
TLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSKGEVPKEWGKLDEWQKELYKHVMRGN
YETLVSLDYAISKPEVLSQTEQGKEPCSWRRPGPKVPDVPVDPSPGSGPPVPAPDLLMQI
KQEGELQLQEQQALGVEAWATGQPDIGEEPWGLSQLDSGAGDVSTDAASGVHSNFSTTIP
PTSWQADLPPHHPSSACSDGTLKLNTAASTE
Download sequence
Identical sequences J9P6F4
ENSCAFP00000041236 ENSCAFP00000034668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]