SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041578 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041578
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-36
Family Second domain of FERM 0.000000957
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-26
Family First domain of FERM 0.00000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041578   Gene: ENSCAFG00000011677   Transcript: ENSCAFT00000048787
Sequence length 831
Comment pep:known chromosome:CanFam3.1:2:71474633:71584266:-1 gene:ENSCAFG00000011677 transcript:ENSCAFT00000048787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGVTNSGQQETQLEELSQEAAEGDNHCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKDVESAKEKCEGGQKEIEFG
TSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHREDPDFETKEGGGLEEC
SKIEVKEESPESKAERELKASQKSIRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRV
CEHLNLLEEDYFGLAIWDNGASKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDIVSGRLPCSFATLALLGSYTIQSELGDYDPELHGAEYVSDFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTDTLPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAAAVDSDRSPRPTSAPAIAQSQDAEGTVPGAPVKKTVVSKAQKETVKDEEKKEE
GPPDQAEPEPTEVWKKKRERLDGENIYIRHSNLMLEDLDKSQEEIKKHHASISELKKNFM
ESVPEPRPSEWDKRLSTHSPFRTLNINGQLPTGEGPPLVKTQTVTISDTANSVKSEIPTK
DVPIVHTETKTITYEAAQTDDSNGDLDPGVLLTAQTITSETTSSTTTTQITKTVKGGISE
TRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences J9P7E1
XP_013962003.1.84170 ENSCAFP00000017167 ENSCAFP00000041578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]