SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042031 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042031
Domain Number 1 Region: 42-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 135-192
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 296-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000324
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042031   Gene: ENSCAFG00000006238   Transcript: ENSCAFT00000043012
Sequence length 688
Comment pep:known_by_projection chromosome:CanFam3.1:1:115897916:115971886:1 gene:ENSCAFG00000006238 transcript:ENSCAFT00000043012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQPSEISSSSVTVEHLTQMMERRAWHSQDPGLLEEEDMTRSLETVTFKDVAVDLTQEE
WQHMKPAQRNLYRDVMLENYSNLVTVGYQVTKPDVIFKLEQEEEPWVIEEEMLGRHCPES
RRGEKSHCTSEVMAEGFKFKDVAIYFSQKEWECLHSAQKSLYRDVMLENYNNLISLGLFD
SKPDVISLLEQEKEPWMVKSKEPKEWCPDWESRKETKNLFSKEHSNEIKSLHMKIKRLTS
SDLECTRVRDNREIKCHLERQQEGHFRQAVIASEERSAAIQCTVQSVPQTIHSRGKTYEC
KGCKETFRCQSHHIQYEKSHNKEKDPKCGECGKVFNSRSNLIKHRRVHESKKSKENKKCA
FIHGSEITKPQSINTGEKPHKCKECGKGFHSSTQLSKHQKIHIGEKPYKCKECGKAFPST
SQLNLHQRIHTDEKYYECKECGKAFTRPSHLLRHQRIHTGEKPHKCNECGKAFRYDTQLS
LHQIIHTGERRYECKECGKVYSCASQLSLHQRIHTGEKPHKCKECGKAFISDSHLIRHQS
VHTGEKPYKCKECGKAFRRGSELTRHQRAHAGEKPYKCRECRMAFTCSTELIRHQKVHTG
ERPHKCKECGKAFIRKSELIHHERSHSGEKPYKCKECGKAFGRGSELNRHLKIHTGEKPY
KCKQCGKAFIRGSHLSKHQRIHTGKRSE
Download sequence
Identical sequences J9P8G2
XP_013970886.1.84170 XP_013970891.1.84170 XP_013970895.1.84170 XP_013970896.1.84170 XP_013970899.1.84170 XP_013970903.1.84170 XP_013970908.1.84170 XP_013970912.1.84170 XP_013970914.1.84170 XP_013970917.1.84170 XP_013970922.1.84170 ENSCAFP00000004118 ENSCAFP00000042031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]