SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042082 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042082
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.21e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.38e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 77-123
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 5 Region: 524-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 336-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000279
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000042082
Domain Number - Region: 296-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0199
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042082   Gene: ENSCAFG00000029540   Transcript: ENSCAFT00000046271
Sequence length 576
Comment pep:known_by_projection chromosome:CanFam3.1:20:56383826:56390521:-1 gene:ENSCAFG00000029540 transcript:ENSCAFT00000046271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVKELLRPVASVLAPTDLTPCWGDPWMVAEVSGSGSGDWGQPWAWASWPLLFPQPCLPW
NLLSQEKRMAAGYLPPWPQEFVTFEDVAVDFSQEEWEMLDPAQRRLYREVMLETCRNLAT
LDALKNQRANMGIEDGTLSPTPASQATSPSSWAGCSLLLPGAAFHLEQGEAMWTGGEGAP
QTSCSDLETSLKSQESIYTKVVLEEEPPSGMNIIKLPKEEWGCGQLEESHEDPHRLLRQM
AFTQVDTLAQKEAIAWHEFGDPCSMNSDLALSQGDSLGKHFLDCNLNIESLVADPFLKHH
QMGYTDQRPCKGNEYAKDVSQNSPLTQHKRTGTCTYAEGGESFNHGTALTTHNTINTVGK
SYECYQCGKVFNRRHSLSEHQRIHTGERPYECQECGRAFTHSSTLTRHLRTHTGEKPYAC
GDCGKAFNRISSLTQHQRIHTGEKPYKCKDCGKSFCQSSYLILHKRTHTGEKPYECNECG
KAFSDRSSLNQHERTHTGENPYECNQCGRAFSQRSSLVRHERTHTGEKPYSCNECGKAFS
QSSSLITHQKTHTSQKTYKIIDCGKAFYQSSHLIGF
Download sequence
Identical sequences J9P8K3
ENSCAFP00000042082 ENSCAFP00000042082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]